Två konsulter och en expert dömer ut kärnkraften

Som svar på folkpartiets och EON:s vision om Sverige som ledande kärnkraftsnation skriver två konsulter och en expert att de hoppas att nästa riksdag river up beslutet om att öppna för större reaktorer. De två konsulterna är: Ulf Ström och Anders Forsbom. Experten är Joachim Elevant. De två sistnämnda arbetar (eller har arbetat) på Sweco med energieffektivisering. Forsbom tycks dessutom ha en nära koppling till FORES. På vilket sätt de skulle vara experter på kärnkraft framgår inte.
Anledningen till att de motsätter sig kärnkraften är den vanliga:

“Kärnkraften är samhälleligt väldigt dyr. Den avger mycket mer koldioxid ur ett rättvisande livscykelperspektiv än flera förnybara alternativ (cirka 6 gånger mer än vindkraft), det saknas ett säkert slutförvar för det långlivade radioaktiva avfallet och det finns en nära koppling mellan kärnkraft och kärnvapen.”

Som taget ur miljöpartiets manifest. 🙂

“Kärnkraften kan aldrig bli mer än en parentes i världens energiförsörjning, då jordens tillgångar på uran och med nuvarande användning och teknik bara räcker under cirka en mansålder”, skriver de tre herrarna.

Och jag ser fram emot Gunnar L:s och er andras kommentarer. 🙂
Uppdatering: Joachim Elevant kan titulera sig energiexpert tack vare en certifiering från Incert. Följande krav gäller för certifiering: allmän teknisk kunskap, erfarenhet av praktiskt arbete samt lämplighet för uppgiften.


Kommentera längst ner på sidan.

  1. Grizzly

    Vilket skämt.
    “Jag är certifierad av ett företag som installerar värmepumpar och kylanläggningar. Kärnkraft är dåligt, för att min mamma sa så….”
    Allvarligt, DN har fallit långt.
    Hur var det nu igen, hur många procent av elpriset var vindkraftsubventioner? Släng tröskverken och bygg konkurrenskraftig energiförsörjning till folket. Och låt oss för i h-e betala vad det kostar, inte vad de sista 5% av landets försörjning råkar kosta. Medelvärden och kostnader funkar finti resten av världen.

  2. Det är väl som med klimatet. Den som har “rätt” åsikt är expert, oavsett kunskaper. Den som har “fel” åsikt är ingen expert oavsett hur väl han/hon kan ämnet.

  3. Om nu kärnkraft är en så dålig affär, kommer ju inga kärnkraftverk att byggas. Om marknaden får råda vill säga. Vari ligger problemet? Det enda problem jag kan se är den huvudlösa idén att gräva ner “avfall” som egentligen är bränsle till moderna reaktorer.

  4. Helge

    Hur kommer det sig att okunskapen är total kring generation 4 kärnkraft bland politiker och “experter”? Är det någon form av frivillig censur kring generation 4 i tidskrifter och SVT? Har någon sett någon seriös presentation? Ser sällan på SVT (eller TV för den delen) numera, så jag vet faktiskt inte om det har varit program kring ämnet.

  5. Mållgan

    Joakim Elevant är teknolog från KTH, vad har du för certifiering Maggie?

  6. Sven M Nilsson

    Pest eller kolera?
    Maria Wetterstrand  bygger sina klimatförslag på “forskaren???” Rockström (mig veterligt har han inte någon reell forskning inom klimatområdet!
    Anders Carlberg bygger sina på Al Gore, fd. politiker och fullständigt i avsaknad av naturvetenskaplig kunskap men en megafon för klimatalarismen.
    Det är det vetenskapliga underlaget för koldioxidskatter, vindkraftverk, elbilar och Gud vet allt!

  7. Är det någon som förstår varför kärnkraft skulle släppa ut 6 ggr så mycket CO2? Eller är det bara en förvirring när man tar någonting ganska nära noll gånger något annat så blir det fortfarande ganska när noll?
    (Inte för att jag tror att det faktiska siffran på ev CO2-utsläpp skulle ha någon relevant betydelse för klimatet…det krävs ju rätt mycket CO2)
    Sedan har väl alla energislag alltid varit en parentes i människans historia?

  8. Micke Johnsson

  9. Micke Johnsson

    Sen har jag en efterlysning! Är det någon som hört av eller sett till Al “the Liar” Gore på sistonde?  🙂

  10. Mållgan: Jag har aldrig kallat mig expert på någonting. Och jag är inte certifierad av någon. Med all respekt för Joakim att han har relevant utbildning för sitt arbete, men jag tvivlar på att han är expert på kärnkraft.

  11. Tack för förtroendet Maggie, jag ligger efter på alla områden och vill komma med något nytt, jag upplever att jag skrivit var mening så många gånger.
    Om jag blir nöjd med min dag slutar den med en kommentar som skapar hopp och framtidstro på detta tema här.

  12. Björn

    Ackrediteringsföretaget INCERT förefaller ha likheten med ett bluffuniversitet där man kan beställa en doktorsgrad. Beställ en certifiering och du kan prata vilket strunt som helst med moraliskt stöd i din certifiering. Åtminstone är detta nog sant om du vill bli kallad energiexpert. Det är nog många s.k. energi- och miljöexperter som behöver genomlysas.

  13. Micke Johnsson

    Jag hittade en artikel skriven av honom på sin hemsida om den ökade ismängden i Norr.
    _an.html.  Hoppas ni inte läst eller skivit om denna innan.

  14. Peter Stilbs

    Maud Olofsson fick en fråga i SVT.s morgonsoffa 7-8 i morse från någon lyssnare – om generation 4-typ kärnkraftverk. Efter en viss trolig hjärtklappning om sådana C-tabun tror jag hon lyckades klämma fram ett stöd för detta i ord.

  15. Peter Stilbs

    Björn #12 – det räcker faktiskt att var medlem i Greenpeace, så kan man utnämna sig till expert på vadsomhelst inom området, klimat , kärnkraft, you name it – utan naturvetenskaplig insikt – det behövs inte, bara ideologin är den rätta
    Ex Martina Krüger – klimatchef (!?)

  16. Rosenhane

    Man baxnar.
    Lars Ohly hänvisar till Jämställdhetsanden, Maria W förlitar sig på Rockström och hans väderleksprofetior.
    Herr Elefant med kamrater och Fru Ternström är rabiata kärnkraftsförnekare medan övriga minkutsäppare och extremfeminister i miljöpartiet nu har utsett sin huvudmotståndare i valrörelsen:

    Den hetrosexuelle västerländske mannen
    Miljöpartiet har pekat ut sina huvudmotståndare | Politiskt Inkorrekt
    Var ska det sluta?

  17. Bo E

    Kärnkraften kan aldrig bli mer än en parentes i världens energiförsörjning, då jordens tillgångar på uran och med nuvarande användning och teknik bara räcker under cirka en mansålder”,
    Läs stycket ovan en gång till men då bara de svärtade orden. Då blir ju budskapet ett konstaterande man t o m kan hålla med om.

    Men endast historie- och anings-lösa  zombies kan sedan vränga till det hela till att bli något så totalt korkat.
    Har sagt det förut i spalterna att det inte är förtroendaskapande att använda ordet aldrig i sambande med teknisk utveckling.
    Eller hur skulle du uttrycka det, Gunnar L.?

  18. Bo E: Lite hyfs efterfrågas. Jag tror att de tre herrarna verkligen tror på vad de säger, så några zombies är de inte.

  19. Björn

    Rosenhane [16]; Man baxnar faktiskt! Det är inte undra på att många väljare drivs i famnen på SD.

  20. Inge

    Bo E #17
    I så fall:
    Vindkraften kan aldrig bli mer än en parentes eftersom det slutar blåsa ett par gånger i veckan.

  21. Toprunner

    Mållgan #5:
    Man får inte certifikat som energiexpert bara för att man är teknolog, det krävs runt 10 års yrkeserfarenhet inom relevant område också. Jag har själv certifierat mig (och är KTH:are).
    Det är däremot skrattretande (i princip ohederligt) att bedöma kärnkraft med enbart det som merit. En glassförsäljare har samma insikt.

  22. Ulf H

    Vattenfall har gjort livscykelanalyser av utsläppt CO2 g/kwh
    Den visar att kärnkraft släpper ut 3g, vattenkraft  5g, vindkraft 10g och elfrån biobränslebaserade kraftvärme 16g, allt per producerad kwh

  23. KristianA

    #22 Ulf H
    Wow, är staten medveten om att de själva ger ut sådana siffror? Kan ju inte var PK?

  24. P Lundén

    Från Fores (en tankesmedja) hemsida:
    Om Anders Forsbom
    Anders Forsbom är energiexpert och arbetar som teknikkonsult på SWECO.
    Således är hela DN-artikeln en gratis annons för konsultföretaget Sweco.
    Någon som har hört ordet textreklam?

  25. Jocke

    Mållgan #5:
    Jag känner många som gått på KTH utan att veta mer om kärnkraft än min knypplande mormor. Den typen av retorik du kör med brukar komma från folk som inte har några andra meriter än vilken skola de en gång lyckades komma in på för 15-30 år sedan.
    Patetiskt, otidsenligt och insiktslöst.
    Påhoppet på Maggie klarar hon nog fint att hantera själv.

  26. Slabadang

    Nu är det väl bara att dra in “Certet” ?
    Det tragiska är all desinformation som medvetet sprids av aktivister genom media. Vad gäller hela miljö/klimatrörelsen så har de liksom ingen heder och hittar i princip på vad som helst.Att tillåta sig ljuga eller medvetet förvränga är en företelse som ökar ju längre ut på vänsterkanten man kommer.
    “Kärnkraften är samhälleligt väldigt dyr. Den avger mycket mer koldioxid ur ett rättvisande livscykelperspektiv än flera förnybara alternativ (cirka 6 gånger mer än vindkraft)”
    Vad är det för ren rappakalja??

  27. Erik

    Jag skickade in ett inlägg i en gammal tråd så det kanske försvann i mängden. Hur som helst så hittade jag en filmad föreläsning av Albert Bartlett, a retired Physics prof. at U of Colorado-Boulder (inklistrat och ej översatt för säkerhets skull…) som i alla fall för mig fungerar bra för att förklara fenomenet med ständig tillväxt.
    Personen i fråga presenterar fakta, inget annat (enligt honom själv),  och jag ser ingen anledning misstro det som presenteras.
    Föreläsningen snuddar egentligen endast vid klimatfrågan men är likväl intressant och i högsta grad relevant i det avseendet.
    Är det någon som känner till personen i fråga eller har synpunkter på det som presenteras (eller kanske på hur det presenteras )?
    Jag är själv skeptisk mot AGW men letar ständigt efter faktauppgifter som kan bringa klarhet.

    PS. Att titulera det hela med “The Most IMPORTANT Video You’ll Ever See” kan ju göra en mer än lite skeptisk, men föreläsningen är intressant oavsett dess youtube-titel. 

  28. Slabadang

    Just nu direktsänt!!! Oxborough stammar svårt under grillning!!!

  29. S. Andersson

    Kärnkraft och kärnvapen är INTE siamesiska tvillingar. I ett kärnvapen behöver man Pu-239. Om man bestrålar U-238 mer än ca 3-4 veckor byggs det upp för mycket Pu-240. Pu-240 käkar neutroner och har man för mycket av det, blir det ingen smäll. Utbränt lättvattenbränsle lämpar sig inte för vapenbygge. Jag tror inte att det finns ett enda k-vapen därute som har plutonium från en lättvattenreaktor. Enklare att tillverka det i särskilda produktionsreaktorer.
    Kom ihåg att det är en jädrans skillnad på kemisk separation och anrikning. I en kemisk separation kan man skilja uran från plutonium men alla isotoper hänger med. I en anrikning skiljer man isotoper av samma grundämne åt. Det är mycket besvärligare… Mig veterligen har inget plutonium från kraftreaktorer isotopseparerats. Någonsin. Kanske har det skett försök men inget i stor skala. Det torde vara mycket knepigt med strålning och kriticitetssäkerhet.

  30. Bim

    Slabadang # 24
    Kärnkraften släpper ut hundrafallt mer C02 än vindkraften.
    Det beror på att den levererar el.

  31. Slabadang

    Elutsläppen från kärnkraften är enorma!!  🙂 Vindkraften släpper inte nästan ut nån el alls?? Var det rätt uppfattat?

  32. tty

    S. Anderson #27
    Inte riktigt sant. Det går faktiskt att göra en fungerande kärnladdning av plutonium från en kraftreaktor, det är bara extremt svårt p g a den höga neutronbakgrunden. Däremot har du säkert rätt i att det inte finns några i verkligheten.
    Jag tror också det blir extremt bökigt att isotopseparera plutonium. Plutonium har hög toxicitet och aktivitet plus en ytterst knepig kemi och massdifferensen är bara 0,4 % jämfört med 1,3 % för uran 235/238,

  33. Bim

    Rosenhane #16
    Miljöpartiet fördömer “den heterosexuelle, västerländske mannen”. 
    Men det är inte riktigt sant. Enligt deras nya logga så är de impotenta heterosexuella männen välkomna.
    Ja,ja! De verkar vara självmordsbenägna.
    Slabadang #29
    Där satt den. 😀

  34. Slabadang

    Ni får inte missa intervjun (vittnesmålet)!!! Trots att han fick förhållandevis “snälla” frågor så är lögnen det genomgående intrycket. “We where to help the University with a problem!”
    Varifrån kom listan om vilka artiklar som skulle granskas?
    Ähhh eeehhhh  jag tror…..ehh…via Royal society tror jag ….ehhhhh..eller kanske inte… jag är ehhhhh …..nästan säker på att inte…CRU själva……eller jag ehhhhh e nästan säker…på öhhhhhh…att jag inte……öhhh kan va riktigt säker… jag är nogg…ehhh näöstan säker på …..att jag inte är säker…..öhh.
    “Varför publicerade ni inte den granskning som faktiskt gjordes?”
    Welll…..öhhhh… …tyckte inte….att det skulle…öhhhh tillföra…något …typ..
    “Men jag sitter med anteckningsar från en av medlemmarna i utredningen som säger att modellkörningar använts som bevis helt utan vetenskaplig grund är inte det intressant information?”
    Welll öhhhh….. well…….öhhhhh……vi bedömde…öhhh……host host host……ehhhh
    Integriteten hos EAs CRU vetenskapen skulle granskas o gissa??
    Oxborough har INTE läst climategatemailen!!!!!!!!!!!!!!!!! De låg inte till grund för bedömningen!!!!!!!!!!!!!!!!!!!!!!
    Ni får inte och kan inte missa den kanske mest pinsamma och avklädande intervjun med den korrupta klimatvetenskapen in person live:

  35. Thomas

    tty #30, det där om toxicitet är sant, men också ett stort problem för upparbetning av bränsle som är en förutsättning för att kunna använda detta mer effektivt än man gör idag. När man tittar på förslag för hur man skall kunna driva reaktorer på gammalt avfall gäller det att läsa det finstilta om hur man tänker sig att göra om avfallet till bränsle.

  36. pekke

    Den ekonomiska vindkraftföreningen Kyrkvind som har andelar i Vindpark Vänern går tydligen inte så bra.
    Det blåser för lite !

    Produktion Vindpark Vänern.

  37. S. Andersson

    tty och Thomas: Visst, jag har också hört om de där försöken i USA med reaktorplutonium och man fick den nog att pysa lite och det blev riktigt skitigt av allt det plutonium som spreds. Men för mig är det lite som att säga att man kan tillverka en bil av papier maché. Det går!
    Vad gäller problemen med upparbetning är de ju väl kända. Inte minst de enorma kostnaderna. Men, det finns fungerande tekniska lösningar som varit i drift i mer än 30 år nu. Det finns all anledning att tro att en ny generation av upparbetningsanläggningar blir effektivare, säkrare och lönsammare, särskilt om volymerna ökar.

  38. Håkan Sjögren

    S Andersson # 27 och tty # 30 : Problemet är att sedan U238 tagit upp en neutron och efter sönderfall blivit Pu239 kan detta vid fortsatt drift i reaktorn ta upp ytterligare en neutron och övergå till Pu240. Det senare är rena rävgiftet vid bombframställning eftersom det sönderfaller spontant. Vid detonation av en plutoniumbomb måste den komprimerade klumpen bestrålas med en kraftig neutronskur i ett tidsintervall på en miljontedels sekund. Om plutoniet innehåller för hög halt Pu240 dvs är reaktorplutonium och inte vapenplutonium riskerar bomben att detonera i händerna på terroristerna  då den är svår att dimensionera. Det är följaktligen mycket enklare att framställa plutonium i speciella reaktorer eller göra som ryssarna – byta bränslestavar under drift. Som exempel skulle den törstige kunna bryta sig in i fabriken i Gävle, stjäla 10 liter Salubrin, hydrolysera detta till ättiksyra och etylalkohol, destillera soppan flera gånger och få sprit som i alla fall har en bismak av ättika (reaktorplutonium) alternativt kan han sätta på en jäsning och bränna själv (vapenplutonium). Vilket tycker Ni verkar enklast? Mvh, Håkan.

  39. Thomas

    Håkan, vad som är enklast beror naturligtvis på vad man har tillgång till för något. Har man bara reaktorplutonium, desperat behov av en kärnladdning och ingen möjlighet att bygga en reaktor för att göra vapenplutonium så får man bygga en bomb av det man har och hoppas på det bästa. Har man å andra sidan desperat behov av att framställa ett land som inte har ett militärt kärnvapenprogram som ett hot kan man också lyfta fram en civil reaktor som ett hot.
    S. Andersson, med tanke på hur existerande upparbetningsanläggningar fungerar får man sannerligen hoppas att eventuella framtida sådana blir bättre.

  40. Slabadang

    Var någon på naturvårdsverkets seminarium “Kan man lita på IPCC”?

  41. S. Andersson

    Håkan Sjögren #36: Jag gläder mig åt att det fortfarande finns någon i Sverige som kan det här. Förresten, vilken fabrik i Gävle är det du talar om, he-he?
    Thomas #37: Och på samma sätt hoppas vi på att nästa generation vindkraftverk faktiskt kan leverera el.

  42. tty

    Thomas #33
    Vid upparbetning behöver plutoniet inte överföras i gasform som vid anrikning. Upparbetning har ju också. som redan påpekats. använts i årtionden i bl a Frankrike och Japan.

  43. tty

    S Andersson #39
    “Och på samma sätt hoppas vi på att nästa generation vindkraftverk faktiskt kan leverera el.”
    Tyvärr är det en ny generation väder vi behöver i så fall.

  44. Bertel

    tty #41
    🙂 🙂 🙂 Den var bra.

  45. Olaus Petri

    tty # 43
    Är det inte det som kallas klimatförändring? 😉

  46. Bertel

    Soorry, tty #43 skulle det vara, men likväl, lika roande och Olaus Petri ligger i samma nivå. 🙂

  47. Bertel

    Slabadang # 34
    Jag tycker att han var hal som en ål(ev pga okunnighet) och gav inga klara svar på frågorna som ställdes(trots(som du säger)att de var “snälla”).
    Han verkare vara totalt oförbered(ev medvetet), inte särkild intresserad i sak att förklara vad han menade, utan med oehört svepande argument besvarade frågorna som till en okunning skolklass vilket ej gör besvär att förstå. 

  48. Slabadang

    OBS Han är inte slipad han är uppenbart korkad.Han erkänner att han var utsedd för att “fixa” Universitetets “problem”. Ramarna för hans utredning sattes upp efter ett möte hemma hos honom med UEAs representanter där grenskning av vetenskapen ändrades till integriteten hos UEAs personal.
    Han bevisar genom sitt vittnessmål att han inte vet någonting om någonting och ljuger så det smäller i väggarna om hur det gick till när de elva artiklarna skulle granskas.Han är fullständigt medvetn om att det är CRU som själva gjort urvalet.
    Intressant är att han öppet erkänner (fast han nog inte fattar det själv ) att den svidande kritik som hans kollega (Acton?) ger CRU ifråga om OVETENSKAPLIGHET där han faktiskt säger att klimatvetenskapen har satt egna och andra andra villkor för hur vetenskap får bedrivas och bevisas.
    Sen kommer den underbara finalen där han håller ett brandtal för AGWteorin och rabblar upp alla sägenomspunna fördomar om “skeptiker” som bara finns. Om han haft en IQ över femtio hade åtminstone hajjat att när “opartiskheten” är under lupp så är det inte så smart att hålla ett klimattalibanskt bönemöte som avslutning! 🙂
    Mannen är uppenbarligen en ren idiot och det var säkert anledningen till att UEA valde just honom!! Han var tydligen beredd att offra både sin heder och rykte på det klimattalibanska offerbordet.
    Han har inte kollat nånting och det enda av värde som hans utredning skapat har inte publicerats dvs protokollen och anteckningarna.

  49. Bertel

    Slabadang #48
    Jag trodde i min enfald(naivitet) att han medvetet gav sken av att vara okunnig och icke påläst(för att slippa undan besvärande frågor). Kunde inte i mina vildaste fantasier tro att inom veteskapliga sammanhang har man skaffat en sk “målvakt”.
    Okunnighet i sakfrågor, men med “politisk” agenda har fått ett nytt innebörd inom granskningen av “klimatvetenskapen”.
    Ingen vacker bild för närvarande.

  50. Bertel

    Slabadang #48
    Forts. Hans  svar(ifall jag förstog Oxborough rätt(har lyssnat enbart en gång på hearingen)) ang kritik  från Acton var häpnadsväckande.
    Klimatvetenskapen har olika “typer” av vetenskaplig “arbetssätt” och ibland väldigt svårtolkade, samt ibland är det vetenskapliga arbetsunderlaget inte tillgänglig pga olika omständigheter????
    Ifall jag har missuppfattat svaren är jag öppen för inlägg. 🙂

  51. Slabadang

    Problemet är ju att dra fram ALLA dumheter och motstridigheter som framkommer i hearingen.Men helt klart framgår att klimatvetenskapens/CRUs  första grundläggande artiklars bakomliggande data är uppätna av hunden. Dessutom så får vi återigen klart för oss att peer review processen inte omfattar granskning och utvärdering av rådata så vad har processen för värde då ? Han tycker vidare att det inte är “överraskande”!…. och man kan ju undra hur han vill att vi ska tolka den slutsatsen?
    Återigen så skymtar den informellt tagna rätten till ovetenskaplighet fram med all tydlighet.Det är liksom hela klimatvetenskapens vagga utan den rätten så står de nakna. Utan “risk för” “sannolikt” “troligen” “många forskare tror” “inte uteslutas att..” så blir det liksom inget kvar.
    Shapiro samanfattar egentligen hela IPCC i en enda mening “Dont make claims when there is no or little evidence”…. han reducerar därmed IPCC s publikationer till en pamflett på tre sidor!!

  52. Göran Lysén

    “klimatvetenskapens/CRUs  första grundläggande artiklars bakomliggande data är uppätna av hunden” Inget ont om mina hundar, då jag litar mer på dem än CRU, IPCC etc etc

  53. Slabadang

    Sorry Göran L!
    Blir jag biten i benet nu? 🙂

  54. Göran Lysén

    Du får ett voff!

  55. Mats

    Ny lönsam kärnkraft av modern typ ger el och framtidens bränslen.
    Det är troligt att Asien visar vägen inom detta område då forskning/teknikutveckling inom detta område inte verkar vara prioriterad – i en annan värld så kunde Asea Atom ha kunnat överleva som ett svenskt teknikföretag och vi kunde “exportera” lönsamma nyckelfärdiga systemlösningar – lyssna på Gunnar….
    Det finns en stor utmaning i att minska energianvändningen – lönsamma åtgärder – detta kan kombineras med nya lönsamma reaktorer, överskott av el och bränslen exporteras.

  56. Gråskägg

    Ser att du länkat till videon även i denna tråd. Verkligen upplysande föreläsning. Man bör se alla 8 delarna.
    “Arithmetic, Population, and Energy”, by Albert Bartlett, a retired Physics prof. at U of Colorado.

  57. Ingemar

    Bishop Hill blogen är full med kommentarer om Oxburgh-förhören:

  58. pekke

  59. Bertel

    Tack för länken.
    Skrämmande läsning(Lord Oxborg,s “svar” blir mer än pinsamma i en offentlig granskning) och samtidigt bekräftande ang politisk styrda forskningsresultat.
    Varför skrämmande?
    IPCC,s raporter ligger som grund(underlag) för hela västvärldens klimatpolitisk agenda(inkulsive Sveriges) med stora ekonomiska konsekvenser och industriell förändring(Vi kan ev förlora all elintensiv industri annonstädes).
    Att sedan Lord Oxborg är en av de som representerar den granskande makten ang IPCC, det är SRÄMMANDE.

  60. Bertel

    #59   Ingemar #57 skulle det har stått.

  61. Bertel

    #59 rättelse. Lorden heter Oxburgh ej Oxborg(lät lite försvenskad) som jag felaktigt skrev.

  62. Så här ser jag kärnkraftens nuvarande situation och möjliga framtida roll för att skapa en globala välfärd.
    Den reaktorteknik som nu används, nästan helt dominerade i civila reaktorer, tar ut extremt lite av möjlig energi från bränslet.
    Ca 70ggr mer får en bridreaktor ur bränslet.
    Våra reaktorer får kanske 30% av sin energi från U238 som blir plutonium och fissionerar, resten från U235 som bara är 0,7% av det ursprungliga uranet, eller vad Toprunner och S.Andersson?
    Det finns vissa smarta civila reaktorer som inte behöver upparbetat bränsle (Candu, vilka med kan upparbeta använda bränsle till nytt, som MOX) men inte ens Candureaktorer kan klara att öka dagens produktion mer med än hundra ggr, vilket krävs.
    Det som kallas för en extrem kärnkraftsutbyggnad är ingenting i verkligheten, det som är extremt är mobiliseringen genom att bygga fabriker för masstillverkning av reaktorer i aldrig skådat antal.
    Dagens uranbrytning har ökat, ett land som Kazakstan har ökat sin utvinning extremt med mycket stor belastning på miljön som följd. Nigeria misstänker jag har eller får liknande problem (men det vet jag lite om).
    Ska vi bygga Gen3 eller det som kallas 3+, så kommer det rent fysiskt inte klara uppgiften, då kommer aldrig ens kärnkraft ge en bråkdel av kolkraften.
    När man debatterar priset för ny kärnkraft i västländer, brukar man ta Arevas misslyckade prototyp som prisnormerande.
    Tar vi i stället det avtal som slöts i slutet på förra åren mellan Arabemiraten och ett sydkoreansk konsortium.
    Emiraten vill inte gå ut med vad det kostade, ty de vill inte att deras kunder ska gå över till kärnkraft före de sålt slut sin naturgas. De köpte fyra APR-1400 för att de anser att de tjänar mer på att tillverka avsaltat havsvatten och elkraft av kärnkraft än sin egen naturgas.
    Det totala priset gick inte att hålla hemligt ca 20G$, då ingår aluminiumsmältverk och en hel del infrastruktur, även för att kunna exportera elkraft till Saudiarabien.
    Dessa produkter har världsmarknadspris så genom att räkna baklänges hamnar man runt 12G$ för 5,6GWe lite drygt 2$/We många brukar kasta in 2,3$/We för att vara över på den säkra sidan.
    Det antas inte vara billigare för Sydkorea att bygga i Emiratet än många andra ställen i Europa, kanske med undantag för de nordligaste områdena, det var ju det arktiska klimatet som gjorde att Areva fick bygga det dyraste två ggr.
    Indien har betalat 1,3$/We för sina senaste reaktorer från Rosatom, men de är troligen subventionerade… Dock ska inga göra sig besvär att offerera Indien dyrare reaktorer än 1,6$/We enligt officiellt uttalande.
    Så ser det ut just nu, dagens uranbrytning är ofta mycket miljöbelastande och den klarar inte att öka faktor hundra på 40 år. Givetvis gäller det inte för mer civiliserade länders brytning. Kolbrytning eller många andra former av gruvdrift är avsevärt mer miljöbelastande, men jag vill att vi ska bygga på system som belastar minst, då duger nog inte uranbrytningen som den nu sker i Kazakstan.
    Äntligen kommer vi in på framtiden som i liten skala funnits sedan 50:talet.  🙂
    Ska kärnkraft spela någon avgörande roll för mänsklighetens globala elkraftproduktion måste vi komplettera med  bättre teknik.
    Jag gillar det Indiska programmet, de startar med billiga reaktorer ofta av Candu-liknande modell, om några år kommer de som då tillverkas redan från start få 40% av energi från torium i exportversionen, den inhemska upp till 60%.
    Indien startar nästa år en i grunden amerikansk snabb bridreaktor, men de har utvecklat den ganska mycket, on full power refuling, alla bränslestavar kan regleras även deras geometri, härden omges av torium som bildar U233 och de drivs av avfallet från reaktorerna i det första steget.
    De ska enligt vissa ryska fysiker klara att bränna alla transuraner och U238 så avfallet enligt dem bara kräver något hundratals år i skyddat förvar, då det blir så små mängder kan de lagras på anläggningen som själv “bara” får 100års livslängd.
    Det Indiska programmet har enorm potential och minskar behovet av uran mot noll på sikt.
    Att utvinna torium är inte miljöbelastande, faktiskt som att utvinna sten eller sand, Indien som har 25% av jordens torium tar det med hjullastare från vissa stränder.
    Torium är inte vattenlösligt som uran och finns i snitt i alla kontinenters berg så att ett billass berg innehåller den energi en amerikan använder under sitt liv.
    Torium är en biprodukt då man utvinner många av de metaller dagens så kallade hållbara energisystem kräver.
    Till detta finns flera andra system där troligen både LFTR och andra snabba bridreaktorer kommer ut på marknaden.
    Nu kan vi inte med den reaktorteknik som är mest använd civilt, påstå att kärnkraft kan klara mänsklighetens behov av elkraft och drivmedel, men…..
    Vi kan med bestämdhet påstå att den reaktorteknik som bedrivits som forskningsreaktorer (och några uppkopplade sedan civil 1973) kan klara uppgiften.
    Problemet för snabba bridreaktorer har varit att de varit för dyra och uran priset för lågt, nu korsar de prislinjerna snart varandra.
    Snabba bridreaktorer, båda natriumkylda och de som kyls med blylegering påstås komma ner till 1,6$/We på bara 10 år.
    Då är visserligen de indisk/amerikanska små toriumhybriderna nere i 0,9$/We men samtidigt ska vi tänka på att alla dagens förvar av en gång använt kärnbränsle (vad är det några Europeiska länder, USA och några till länder som de Afrikanska och Sydamerikanska) bör destrueras och då kan det kompensera för ett högre pris på reaktorer.
    Så har vi Jokern i leken… LFTR… den kan byggas som en kombination av termisk och snabb brider, den kan komma ner till 0,5$/We…
    Experterna i det debattinlägg som är upphovet till detta av maggie kan väl komma med konstruktiva kommentarer på denna min kommentar?
    Jag skriver ur minnet och är trött som fan i gubbskallen så jag kan behöva lite motstånd för att precisera och ge källor till allt.
    Som fördjupning bör alla kunniga se David LeBlanc från februari 2009
    De som vill fördjupa sig och inte redan är mycket insatta bör “bläddra” lite på Kirk Sorensens blogg och se hans föreläsning, alla länkas till på högersidan.
    De som inte orkar fördjupa sig, ska tänka på det var gång de påstår något om kärnkraft, en Åke S rekommenderas att plugga på en del  😉 .
    Jag har en dröm:
    Att alla som deltar i kärnkraftsdebatten åtminstone lyssnar på föredragen i vart fall de som vänder sig till de som är helt novis i ämnet.
    Jag har en dröm:
    Att alla som deltar i energisystemsdebatten inser vad som krävs för en global välfärd.

  63. Labbibia

    Tack Gunnar!

  64. Bertel

    Du har gjort en utmärkt genomgång. Tack!!!!

  65. Erik L

    34# Slabadang
    Tack för länken till förhöret.
    Herregud, Har denna “oberoende kritiskt granskande grupp”  i tre veckor suttit och fikat med Jones och grabbarna, traskat runt lite och tittat på institutet, kikat igenom knippe papper (utvalt av CRU själva förståss) , och kommit fram till att inget fel kunde hittas!
    Hur “oberoende” han är avslöjar han när han i förhöret håller ett långt brandtal för AGW teorin, och passade även på att påstå att skeptiker i USA minsan får pengar av lobbygrupper liknande tobakslobbyn mm. Hur skulle denna man kunna leda en kritisk utredning av CRU?
    Hans uppenbara “CRU kramande” måste bara leda till att en ny utredning tillsätts, ingen av de närvarande vid detta förhör kan väl med rent samvete låta denna mans utredning på 3 sidor (eller var det 4?) helt rentvå CRU.

  66. Slabadang

    Erik och alla!
    McIntyre han e såååå skön. På climateaudit har han lagt ut det detaljerade schemat för Oxburghs Norwich vistelse ,taxi ,luncher fika pauser ,lokal ….rubbet….. hur fasen kan Oxburgh vara så jubelkorkad att han blåljuger om så lätt kontrollerade uppgifter.

  67. Christopher E

    Gunnar #62;
    En mycket läsvärd genomgång och allmänbildning. Stort tack!
    Slabadang, tack för länk till förhöret. Jag har inte hunnit se hela iväll, men jag ska. Vitvätten av Climategate har misslyckats. De blir inte av med den. Som skeptiker känns det nästan overkligt hur AGW-bygget rasat senaste året. Jag minns en skeptisk föreläsning jag höll för många år sedan, men 4 pers i publiken… 🙂
    Då var man en sällsynthet och en bisarr figur. Idag visar det sig att man satsat rätt på magkänslan från början.

  68. Eric  #27.
    Efter att ha sett de 8 avsnitten av prof. Bartletts enkla räkneövning, så inser man att det mesta som nu debatteras på denna blogg ,  är betydelselöst och slöseri med intellektuell energi.  Annan uppfattning om detta är intellektuellt oärligt.  Man blir ju  Rockström fan för mindre.

  69. Mats

    Starkt Gunnar Littmarck, – och så detta med energiskatter, skatt på el och framtida nya bränslen till våra fordon bör anpassas så att det lönar sig attt bygga systemlösningar som begränsar energianvändningen – god tillgång på el och bränslen skapar välfärd och framgång – och dessa skatter behövs för att klara statens åtagande…..
    Gunnar, och vilken väg ska då tex våra nuvarande reaktorägare i Sverige välja? – finns det anledning att studera hur tex Scania ser på framtidens bränslen – finns det affärsmöjligheter i denna utveckling…..

  70. Littmarck #62
    Alltid lika trevligt att läsa dina inlägg som propagerar för det som kan lösa flertalet av världens problem. Och nej, för en gångs skull är jag inte ironisk. God tillgång till billig energi är en nödvändig förutsättning för ekonomisk välfärd. Det krävs ingen Einstein för att räkna ut det. Däremot krävdes det en Albert Einstein för att räkna ut hur man producerar den billiga energin… Jag vill ha en sådan där kärndriven bränslecell som används i rymdsonder stående i källaren. Det räcker bra med en modul som levererar 10 kW i fyrtio år. Den är stor som två väfyllda A4-pärmar. Fast det vore kanske mer kostnadseffektivt om det lokala el/värmeverket införskaffade en Thoriumreaktor på 50 MW? Eller skall vi tapetsera landskapet med väderkvarnar (80 öre/kWh) alternativt täcka alla hustak med solceller (400 öre/kWh)? Hej då basindustrin, ha det så bra i Finland!

  71. Kent S

    Missa inte denna artikel.
    After a Year of Setbacks, U.N. Looks to Take Charge of World’s Agenda

  72. Tackar, för alla snälla ord, vilket trevligt start på en ny dag. 🙂
    Visst borde vi gå vidare och peka ut framtiden?
    Visst borde vi varva kommentarer som belyser att CO2-hotet är vetenskapligt avvisat för de allt färre som agerar som om de ännu inte insett det, med konstruktiva lösningsförslag?

  73. Bertel

    Slabadang #66
    Måste lyfta hatten av för McIntyre,s idogt arbete, som han delar med sig och visar åter hur horribelt illa det är stält med hela granskningen av CRU med Lord Oxburgh i spetsen.
    Ser framemot att läsa hans analys av hearingen som han skulle komma ut med i dag(enl vad han skrev på bloggen). 
    Rekomenderar ett besök under dagen för att läsa McIntyres analys.

  74. Labbibia

    Ox(salsyra)burgh funkade inte heller på de fula fläckarna i klimatforskningssmutsen………
    Klorin kanske kan göra jobbet? 😉
    Och för den som kanske inte förstod “vitsen”

  75. Bertel

    Klockren ironi. 🙂

  76. arga gubben

    I dag snurrar vindkraftverken för tredje dagen i rad här i Kristianstad. Kan det finnas hopp ändå??

  77. Pär Green

    arga gubben # 76
    Läs på
    Så kan du själv se hur vindsnurrigt det är!
    Vill du ha el ofta eller konstant?

  78. Bäckström

    Gunnar 62#
    Tack för en genomtänkt genomgång om läget på kärnkraftfronten.
    Jag har en stilla fråga till dig.
    För en novis är det inte så lätt att lotsa sig igenom Kirks Sorensens eller david LeBlanc:s alster. Jag har följande fråga till dig:
    Som jag förstått saken så är begreppet 4:e generationens kärnkraftsverk i själva verket 6 olika tekniker/angreppssätt. Är det korrekt?
    Jag skulle hemskt gärna vilja ha en förenklad punktlista på dessa med + och -, alltså fördelar respektive nackdelar vad gäller de olika typerna. Det kan till exempel vara frågan om säkerhet, kostnad per KW/h, förmåga att köra på befintlig kärnavfall, biprodukter som plutonium med risk att kunna användas i vapenframställning etc.
    Jag har inte lyckats hitta sammanställning över detta. Kanske du har någon lämplig länk att peka till?

  79. Bäckström;
    Du starta med svenska wikipedia
    Så fortsätta med den engelska på temat gen4
    Wiki anger från 2002 då de sex, genIV modellerna utsågs, då ansågs det att 2030 var priserna på uran, olja, kol och gas, så höga att det motiverade dessa reaktorer.
    Pytt…. Kina och Indien växer med nästan 10% om året, det ger en dubbling vart 7:de år… för knappt 3 ggr västvärldens hela befolkning, bara för de två länderna.
    Inte trodde någon att utvecklingen skulle ta en sådan fart 2002?
    Du ska tänka på att utvecklingen av kärnkraft var stark till mitten av 80:talet, därefter har ett mycket lågt pris på olja, kol och gas, i kombination med ett folkligt missnöje i Västvärlden, lett till i det närmaste stiltje, till de sista åren.
    Även Ryssland har lagt sin utveckling på is under denna period, BM-800 startade på papperet 1986… kom igång igen först på senare år då allt fler insåg att olja aldrig kommer kosta 10$/fat mer.
    Nu har de gått så långt att den fjärde generationen (startade på 60:talet så BM-350 och BM-600) av BM Gen IV startar 2012 och en till i Ryssland två i Kina påbörjas. (egentligen kan man diskutera om alla snabba bridreaktorer kan kallas IV-Gen, jag skulle vilja ha en kravspecifikation, typ hur mycket energi som frigörs ur en given mängd uran och hur stor mängd långlivat avfall/TWh som skapas).  Om man driver en LFTR så kan man såklart se till att bara ta ur de kortlivade restprodukterna och till sist kommer var enda enskild uranatom, klyvas eller bridas till något som klyvs. Dock om man någon gång processar bränslesaltet så kan man inte hindra att någon del plutonium kommer ut, ingen process är 1000promille sluten, det är lite akademiskt för oss, men säkert inte för Åsa Moberg…
    Någon gång slutar mänskligheten med LFTR då finns det en massa bränslesalt där först 999999 delar av en M tas bort, så får den miljonte delen antingen slutförvaras eller genomgå någon form av transmutation utanför reaktorerna.
    Rosatom utvecklar redan BM-1200 och den slutliga….??? BM-1800.
    Samtidigt utvecklar Rosatom den lilla U-båtsreaktorn som IAEA sedan flera år lovordat som en lämplig masstillverkad GenIV reaktor.
    De som arbetar i dagens svenska kärnkraftsindustri sysslar nog inte så mycket med helt nya modeller, det går att krama ut en hel del till ur de som finns och svensk kärnkraft har inte en krona för att planera framåt mot de senaste konstruktionerna.
    Jag är dock helt säker på att det blir ett annat ljud i skällan redan då Indien startar sin första civila GenIV och året efter då BM-800 startar… då kan inte politiker eller ekonomer blunda längre.
    Det vore kul att få Topruners tankar på det inifrån dagens svenska kärnkraftsindustri.
    De jag mött inkl. doktorer har haft en ganska låg inriktning på system som har potentialen att priskonkurrera ut dagens billigaste energisystem.
    De borde inse att det är det ända motivet för framtida kärnkraft.
    Den akademiska världen är ofta mer inriktad på anslag och forskning än förutsättningarna för den globala utvecklingen.
    Industrin rättar sig efter de signaler som ges från politiskt håll.

  80. Bäckström

    Tack för infon och länkarna!
    Jag ska studera dessa. Precis som du tidigare antytt, verkar inte politikerna ha en sportskeps om 4:e Generationen. Faktum är att jag mailade samtliga partier med frågan: “Vill ni  satsa på 4:e generationens kärnkraft?”
    Svaret från de jakande partierna var…..
    …Ingen hade en susning om vad det var för något! Men att man var för utbyggnad rent allmänt.
    Vad har makten för rådgivare egentligen?
    Hur uppdaterad är den, hur kompetent?
    Det känns som Hans Roslings analyser är korrekta.
    Vi lever kvar i en världsbild som var någorlunda korrekt 1970, men inte nu.
    Indien, Kina, Tjeck(oslovakien) 😉  Är väl ändå “Uland”

  81. Bäckström

    en sak är ju säker.
    Ska man “sälja” 4:e genarationen till allmänheten så kan det inte heta saker som:
    • Very-high-temperature reactor (VHTR), Låter farligt
    • Supercritical-water-cooled reactor (SCWR), låter ännu farligare
    Lead-cooled fast reactor (LFR), nej bly är farligt
    Men dessa skulle kunna funka:
    • Molten-salt reactor (MSR),  ja det där låter mysigt och hållbart 😉
    • Gas-cooled fast reactor (GFR), nja kanske
    • Sodium-cooled fast reactor (SFR), nja, kanske

    Summa sumarum ur social-emotionellt perspektiv.
    Smältsaltreaktor vinner här. 😉
    En slump?

  82. Mats #69
    Först måste jag skriva att jag har den största beundran för Scania, hoppas deras företagskultur inte blir besudlad av nya ägare.
    Så mina förslag till Scania, är nog lite larviga…  😉
    Satsa inte på DME som Volvo.
    Det storsatsas nu på naturgaskonvertering av lastbilar, men jag är övertygad om att syntetisk diesel blir det bästa om inte vätgaslagringen lyckas utvecklas till en konkurrenskraftig teknik.
    Jag anser att det är smartare att tillverka syntetisk diesel än DME, de energiförluster som uppstår blir ju värme, vilket kan användas.
    Om man tillverkar syntetisk diesel från förbränning av brännbart avfall, kan restvärmen förvärma vattnet, med motströmsvärmeväxlare.
    Det går kanske att få ut ett syntetiskt drivmedel som bara är 30C varmare än ingående vatten och bränsle?
    Tänk att bränsle ger värme och CO2, CO2 förenas med väte från vatten, vattens syre matas in med luft i förbränningen.  Ut får vi kall kvävgas, aska och basen till syntetiskt drivmedel…
    Samma om man tillverkar det syntetiska bränslet av 900C från högtemperatursreaktorer.
    Om jag vore en beslutsfattare i något kärnkraftsägande bolag i Sverige eller Tyskland, skulle jag sätta samman en liten grupp som leddes av någon som jag.
    Den gruppen skulle resa till Kina, Tjeckien, Ryssland och självklart Indien.
    Vi skulle ordna seminarium med de bästa från energyfromthorium för att väcka intresset snabbare och få upp synen på möjligheten att skapa en global välfärd och alla fördelar med det.
    Vi skulle delta i alla TV-program och debatter som givetvis skulle bli resultatet av detta budskap.
    Vi skulle köpa kostnadskalkyler och öppna offerter så mycket vi kunde, vi skulle redovisa alla projekts framdrift med reportage och bilder från Kjell Duberg.
    För ganska små belopp skulle en sådan grupp driva politiken mot en fri utbyggnad av kärnkraft.
    Sen skulle jag om 10 år gå vidare med en grupp som pekar på alla möjligheter mänskligheten har, Hans Rosling vore en självklar förmåga att försöka vinna in.
    Vi skulle bilda en motpol till romklubb och tällbergs människo och utvecklings fientliga budskap.
    Yes we can

  83. #81  Alvin Weinberg hade nog rätt, det är den bästa tekniken för en global välfärd, med alla mått mätt, inte minst de emotionella.
    Torium är bättre än uran på väldigt många vis, och inte lika läskigt i de okunnigas öron????eller vad Åsa?
    I längden tror jag inte att en teknik stoppas eller vinner, p.g.a. vilka signaler vissa får.
    Med tiden ger orden de signaler som tekniken har levt upp till.
    Om vi aldrig mer byggde en uranreaktor, skulle nog en del av mänskligheten känna obehag av ordet uran i några generationer.  (att toriumcykeln innebär att man tillverkar uran, skulle kanske inte den gruppen inse??).
    Om det däremot snart är urandrivna reaktorer över allt kommer ordet uran få en positiv klang även i länder som Sverige om bara något tiotal år.
    Det är så enkelt, se bara till att priset på elkraft och drivmedel faller kraftigt i samma takt som de nya reaktorerna tas i bruk, människor kopplar helt korrekt då ihop den nya friheten och det kraftigt ökade välståndet med uran.

  84. Bäckström

    Tänk om logik skulle bita på människorna. Vad mycket bättre allt hade varit. Folk är ju mycket räddare för att flyga än att köra bil trots att det logiskt borde vara tvärtom.

  85. Labbibia

    Gunnar L
    Skulle man inte kunna använda överskottsvärmen från en bilmotor till att ladda batterier? Värme=energi.
     I dag transporteras ju värmen bara rakt ut i luften, via kylsystemet-kylaren.
    Jag tänker närmast på de hybrider som finns idag. kanske ytterligare ett sätt att ladda batterierna förutom de som redan finns.
    Eller finns det redan?

  86. Labbibia

    Gunnar L (igen)
    Eller tänk tanken att man “klär” undersidan av motorhuven med “solceller” som tar tillvara spillvärmen från motorblocket?
    Nu spånar jag ju naturligtvis, men med tanke på att verkningsgraden är så låg på Ottomotorer, kanske kan det vara en idé?

  87. Labbibia stora farygsmotorer gör det, jag tror jag har bilder och beskrivningar från en 80MW från Wärtselä som jag fick från Thomasj på min blogg…
    BMW har något liknande.
    Bilmotorer skulle vara helt annorlunda om det inte vore för det att en bil inte får kosta mer än runt 100.000:- att tillverka… tiodubbla det som för kanske flygplan…. då skulle bilar vara konstruerade på helt andra vis.
    De billigaste bra bilarna kostar kanske 40-50:-/kg att tillverka, utom skatter, garantier, frakt och grossist med detaljist påslag.
    Om de fick kosta 1000:-/kg  en miljon för en bil på ett ton… då du Labbibia….
    Nu finns de ju bilar som kostar mer än så men då är det extremt små serier där utveckling, reklam och vinst måste tas ut på få bilar.
    Får BMW MB Toyota och någon till en beställning på 500.000 bilar var där de får kosta 25ggr mer än idag att producera, vilka bilar….
    Har man 900C i närheten av en turbo men efter en katalysator, kan man tillverka vätgas av det som kan injekteras i förbränningen… det du Labbibia, då skulle vi närma oss den vattendrivna bilen… till kanske en fjärdedel??? en bil som nu drar 0,5l/mil skulle kunna dra 0,37l/mil????

  88. Förresten lär Sandias labtester (var de de?) ge verkningsgraden upp till 60% vid vätgastillverkning med vatten och 900C.
    Då borde en bilmotor kunna få mer än en fjärdedel av sin energi ur det.
    Undrar vad motorgeniet Hedman skulle få ut av att leka med det, till sina övriga funderingar???
    Sorry nu komm jag helt av spår igen… ger mig  🙂

  89. Labbibia

    Gunnar L
    Jaha, försent ute som vanligt då.
    Men, de hybrider som finns idag laddas väl med dels generator, dels med hjälp av “motorbromsgeneratorer”?
    Kan väl inte kosta många spänn att på något vis “sätta kylaren under tryck” (a´la ångmotor) och uttnytja det för ytterligare batteriladdning? Men det kanske inte behövs?
    Hursomhelst, det verkar onekligen vara ett enormt slöseri med energi i våra kära “Ottos” 

  90. En sista, de effektivaste bilmotorerna idag ex. min gamla Audi 1,9TDI i en Skoda kombi, har så bra verkningsgrad att värmen inte räcker då det är under 30C… Vi måste bygga bilar med tvåglasrutor, med kryptongas mellan och reflektering av långvågiga fotoner, de kommer dessutom bli elektriskt tonbara så solvärmen reflekteras bort, då det trots allt är värme som är bilismens globala problem.. Lika dan teknik hoppas jag lycks få snart till mina fönster.
    De ska vara treglas med kryptongas, givetvis inga karmar eller bågar, givetvis tvärt emot de flesta vill jag ha den reflekterande ytan på utsidan av det innersta glaset och den elektriskt styrda dimmern på insidan av det yttersta, utsidan måste beläggas med titanoxid, så att inte kondens och is, lämnar ränder (och jag slipper putsa annat än insidan…)))

  91. Jag ger mig inte, förlåt maggie…
    Labbibia, säg inte det om du går in på autobloggreen och bläddrar ett tag finner du vad superkritisk bensin kan göra för OTTO´s verkningsgrad, än är nog inte den motorn död…

  92. Labbibia

    Ber också Maggie om ursäkt om det spårar ur, men fossilbränsledrivna bilar är ju i allra högsta grad relevanta i klimatfrågan.
    Gunnar L
    “Superkritisk” bensin i all ära, men nu tänker jag på dagens motorer. Alla som någon gång öppnat kylarlocket på en varm bil förstår vartåt jag syftar. Har jag helt fel om jag påstår att den energin för en billig penning borde gå att utnyttja? 

  93. Labbibia #85 & #86
    Kul spånande.
    Men jag tror att effekten av att utnyttja värmen från den nödvändiga kylningen av en vanlig bilmotor är ungefär lika stor som att lära föraren av bilen att köra på ett bränslesnålt sätt. Och utan att minska behovet av fart och komfort och restid.
    OBS! Jag vet inte hur du kör bil, men jag tror att många skulle kunna spara massor av pengar på en kurs i effektiv hantering av bilen.
    Jag har ibland haft tillfälle att köra en bil som enligt tillverkaren klarar 0,74 liter per mil. Och bilen har en färddator som visar senaste medelförbrukning.
    Jag har lyckats pressa ned den till 0,64 liter per mil på långkörning trots att ägaren har svårt för att nå 0,81 liter per mil…
    Och då handlar det inte om någon “meskörning” från min sida.
    Omkörningarna sker med fart och fläng när dom behövs.
    Ett annat alternativ är väl att utnyttja luftmotståndet bättre och sätta små vindsnurror som är datorstyrda och servostyrda så att dom utnyttjar luftströmmarna som virvlar åt “fel håll” så att säga.
    Det finns ju inte bara spillvärme från en bil, det finns luftrömmar och friktion och knepiga förare som har en stor utvecklingspotential.
    En annan variant vore en enmansbil som sammanlänkas med en för två, tre, fyra eller fem eller fler beroende på hur många man är som reser för tillfället till samma plats. Eventuellt behöver inta alla åka hela vägen. Och kanske kan man koppla på en extra modul om någon längre fram vill åt samma håll.
    Det tror jag på. Så ska det naturligtvis bli. Alla har en egen modul parkerad vid någon genomfartsled och alla har en transportmodul hemma.
    Total frihet för allla som vill, och ett kul sätt att träffa nya människor på sina resor utan trängsel med snuviga människor i unkna tunnelbanor.
    Men jag talar naturligtvis utifrån ett glesbygdsperspektiv där det saknas tunnelbana och bussarna bara går fyra gånger per dag. Bort två gånger och hem två gånger.

  94. Thomas

    Labbibia #85, att utnyttja spillvärme är inte så lätt att göra effektivt. Man kan köra en ångmaskin eller Stirlingmotor på en temperaturskillnad, men det är knappast ekonomiskt att stoppa in en sådan i en bil bara för att ta tillvara spillvärmen.
    Sen finns termoelektriska element som direkt kan omvandla en temperaturskillnad till elektrisk energi utan några rörliga delar. Idag är de dyra och har inte så bra verkningsgrad och används nästan bara åt andra hållet, för att producera kyla. Skulle man kunna bygga ett sådant element med god verkningsgrad till låg kostnad skulle effekten på samhället kunna vara nästan i samma klass som en billig solcell eller rumstemperatursupraledare.

  95. Labbibia

    Uffeb # 93
    Små vindsnurror…..nej, det ger ingen energivinst, vilket en viss kommunalpolitisk Vänsterpartist blivit varse. Missat det?
    Egen modul? Som en sittplats i en buss, enda skillnaden skulle vara att det var glasväggar mellan passagerarna? Tja, som du säger, skyddar mot förkylningar, men rätt opraktiskt för övrigt?
    Med tanke på att du som sagt talar ur ett glesbygdsperspektiv, är det inte rätt roligt att prata med de få grannarna om ni träffas på bussen?

  96. Bäckström

    Jag tror mer på att ta till vara på bromsenergin och ladda batterier, typ som F1 kärror gjorde för ett år sedan via KERS-systemet. Tekniken för detta finns ju redan så… kanske är för dyrt fortfarande?

  97. Labbibia #95
    Ironi fungerar dåligt i det här formatet.
    Men den här gången trotsade jag mot mitt eget vetande. Bara för att se om jag hade fel. Men det hade jag inte.

  98. Labbibia

    Thomas # 94
    Kylsystemet i en vanlig vattenkyld  bensinmotor är ju redan på sätt och vis en “ångmaskin”. Återstår bara ett sätt att “återvinna”, eller snarare omvandla, energin som med kylvattnet transporteras till kylaren……Borde inte vara så svårt?

  99. Labbibia

    För undvikande av missförstånd, skriv gärna ex (ironi) eller 😉
    när/om, du skojar. Som du själv så gärna brukar påpeka, ironi fungerar sällan enbart i skriven text. 😉

  100. Bäckström #96
    Att utnyttja rörelseenergin vid inbromsning är smart och har funnits länge i olika former.
    KERS-systemen som användes i Formel 1 var inget nytt, men det var annorlunda.
    Långt tidigare fanns det bussar i lokaltrafiken i Stockholm som bromsade vi hållplatserna genom att sätta fart på ett stort och tungt svänghjul. Den rörelseenergin användes därefter för att starta och dra iväg från hållplatsen.
    Ingen avancerad elektronik. En helt mekanisk lösning.
    Vet inte om det finns kvar.
    När det gäller Formel 1 så fanns det ett par olika lösningar.
    En byggde på att man drog igång ett pyttelitet svänghjul i kolfiber i en enorm hastighet för att kunna återanvända under några få sekunder per banvarv. En annan byggde på att man snurrade en elgenerator som laddade kondensatorer med högspänning som via en elmotor också bara kunde användas under lika många få sekunder.
    Eller om det var tvärtom. Men bromsenergin är värd att utnyttja. Mer värd en värmen från kylningen av motorn.
    Och därför kan man tjäna massor på sin bilkörning genom att lätta på gasen i tid utan att ge avkall på plattan i botten när det behövs. En insprutningsmotor drar ju nästan ingenting vid motorinbromsning.
    Men visst vore det kul att kunna lagra inbromsningsenergin så att man kunde köra ännu häftigare. Risken är väl att man skulle få däckstjut både vid inbromsning och start vi rödljusen… 🙂

  101. Labbibia #99
    Förlåt mig 😉

  102. Bäckström

    “Men visst vore det kul att kunna lagra inbromsningsenergin så att man kunde köra ännu häftigare. Risken är väl att man skulle få däckstjut både vid inbromsning och start vi rödljusen… ”
    Jag kallar det för livskvalité 🙂

  103. #95
    Avser du möjligen riksdagsmannen Peter Pedersen(v)? Han som ville ladda elbilar under körning med hjälp av små vindkraftverk fästa på bilen. Perpetuum mobile uppfunnen igen. Inför TV-kamera. Samme Pedersen undertecknade motionen om att förbjuda patent på logaritmer:
    Jaja, det skulle väl falla de matematiskt utmanade på läppen. 😀

  104. Labbibia

    Bromsenergin tas redan tillvara i moderna hybrider. varför inte använda även spillvärmen från motorn? Inte bättre, men ett komplement, en effektivisering av motorn.
     Formel 1-lösningar handlar väl alltid om att få ut maximal fart/effekt?! Min tanke var ju att få ut lite extra energi för att ladda batterierna i en hybridbil ännu effektivare.
    är det så tokigt?
    Och Thomas, om man kan använda solceller för att ladda ett båtbatteri, varför kan man inte använda värmen som strålar ut från ett motorblock för att ladda ett bilbatteri? Finns det någon principiell skillnad? 

  105. Labbibia

    Osynlige mannen # 103
    Alla rätt! 😛
    Och tack för länkarna! Borde visas för skolungdomen på fysiklektionerna!

  106. Håkan Bergman

    Dom smarta fransmännen har börjat komma med ny teknik för energiåtervinning i bilar:
    Scania jobbar också på:
    Överskottsvärme sommartid borde kunna driva AC’n, ni minns väl dom gamla Electroluxskåpen utan kompressor, finns väl gasoldrivna fortfarande.

  107. Slabadang

    Osylige mannen !!
    Hur tokigt kan det bli inom V??  🙂  🙂  🙂   My gooood!! Oj jag väckte lilltjejen som undrade vad som e så roligt så att pappa skrattar högt!
    Frugan surnade  också till men när jag visade ditt inlägg och videon o motionen så garvade vi alla tre!!!!! Pappa är förlåten det är svårt att bara le när asflabbet är på sin plats! 🙂

  108. Labbibia

  109. Labbibia #104
    Kul med spånande. Även tokiga idéer kan leda fram till nya tankebanor och ännu bättre idéer.
    Nu kan man ju inte bedriva en effektiv “Brainstorming” i det här formatet, men det kan i alla fall komma fram ny kunskap som inte alla kände till. Tror jag. Och de som “redan visste” kan ju berätta det, men bidrar ju inte så mycket till spånandet.
    Ska kolla Håkans länkar senare… men troligen menar han att det finns intressanta lösningar för att utnyttja spillvärme från kylningen av förbränningsmotrorer?

  110. #107
    Ofrivillig humor är alltid bäst. Min favorit på senare tid är förstås Karin Svensson-Smith (tidigare VPK, numer MP) som ville lägga räls för höghastighetståg på halva E4:an. Tåg välter i skarpa kurvor. Men Karin kanske menar att 50 km/h är hög hastighet? Det hade kanske behövts ganska starka lok mellan Jönköping och Ödeshög också? Det här är alltså de bästa representanter de lyckats skrapa ihop? Detta är crème de lá crème! Götterdämmerung.

  111. Labbibia

    Undrar hur mycket bensin/diesel-motorns generator drar, eller snarare höjer bränsleförbrukningen per mil? Multiplicera med 3 miljoner bilar, och deras körsträcka i mil bara i Sverige.
    Tänk tanken att använda motorns spillvärme för samma sak istället. Bara en spånig tanke? Förmodligen……

  112. Håkan Bergman

    Osynlige Mannen #110
    Den damen har många vilda idèer, hon ville väl lägga ett par järnvägsspår på Öresundsbrons körbanor i samma veva. Tror inte att man tog med sånt när man hållfasthetsberäknade bron, men sånt betyder väl inte så mycket i MP’s värld.
    Jönköping-Ödeshög får nog lösas med lok med kugghjul anar jag.

  113. Labbibia #111
    Jo det är nog en hel del. Och lägger man till AC-anläggningen så blir det nog intressant att titta på motorns spillvärme som en outnyjad bibrodukt. För att inte tala om värmen i kupén när bilen stått parkerad länge en varm sommardag, och avgasrörets temperatur efter den värme som katalysatorn behöver.
    Och tänk på vilken värme sol och fem personer i en bil kan generera under en långresa med stängda fönster och utan luftkonditionering.  Det sista var  😉  men det kanske kan generera nya tankar hos andra.

  114. Toprunner

    Gunnar L #79: Forskningsreaktorer i all ära men det som blir spännande att se i närmaste framtiden är driftsättningen av Kinas 4 byggen av AP1000 reaktorer. De byggena går helt enligt plan och den första driftas om några år.
    AP1000 är ju en design som till och med politiker kan gilla (förstå)… kanske det kan bli en i finland?

  115. Helge

    Motorn är inte bara varm för att värme är en restprodukt, den fungerar helt enkelt effektivare vid högre temperatur. Det fanns bl.a på SAAB funderingar på att lägga varmvattnet i en “termos” nr motorn stängdes av, så att motor uppnådde arbetstemperatur direkt efter den stått t.ex över natten. Vissa dieselmotorer är så effektiva att de inte klarar att värma sig själv tillräckligt snabbt, så man har lagt in elvärmare för att snabbt komma till optimal arbetstemperatur. Gäller speciellt om överskottsvärmen dessutom ska värma kupén.
    Om det fanns ett ekonomiskt viss att ta tillvara ytterliggare värme hade man gjort det ögonaböj, för vad du efterlyser är det alla jobbar på, effektivare motorer som belastar miljön minimalt.

  116. Thomas

    Labbibia #104, solljus har en temperatur på 6000 grader vilket är 20 ggr mer än omgivningstemperaturen. Det är principiellt lättare att utvinna energi ju större denna temperaturskillnad är. Att försöka tillverka motsvarigheten till en solcell som fungerar på långvågig IR lär bli svårt.
    Appropå vindkraftsdrivna bilar var det för en tid sedan hetsig debatt på ett antal bloggar om huruvida man kan få en bil att gå mot vinden driven endast av en vindsnurra, och resultatet blev att det går precis som det går att segla mot vinden.

  117. Håkan Bergman

    Det blir bara så breda vägar!

  118. Gunnar Littmarck #82,
    Enligt dagens PiteTidningen skedde i går invigning av prototypen till DME produktion i Piteå med närvaro av kineser och japaner, som är intresserad av den nya tekniken att omforma lignin från ved till Bio-Dme.  Testanläggningen producerar 600 ton/år till  bl a  15 Volvobilar.   Svensk skogsindustri processar  80 milj. kbm ved till pappersprodukter, varav ca hälften genererar ca 5 milj. ton/år lignin som möjlig råvara till bio-diesel.  
       Nyligen invigdes  Pite Markbygdens  Vindkraftpark med  ca 8 TWh elproduktion inom 10 år.  ( 8 st  är monterade).
       Kan du uppskatta kostnaden för drivmedel med processen  
    el (1 kr/kWh) ->  H2O -> H2 + CO2 -> CH4 -> drivmedel enligt Olah,  om man kan ta tillvara överskottsvärme?  En ekonomisk gräns är väl ca 10 kr/l  bensinekvivalent.   Till kommer samhällsnyttan av att inte behöva släppa ut strömmen på elnätet, utan tillvara den genom lokal produktion av drivmedel i ett  industriellt kluster.   

  119. Toprunner

    Holmfrid #118:
    Det gäller ju bara att hitta ersättare för det ligninet i massaindustrin eftersom man redan använder det som bränsle idag i sodapannor o.dyl. Man kastar liksom inte bort det.

  120. 118#
    Om tekniken ska berika och inte utarma måste DME kosta 3:-/l att tillverka.
    El 25öre/kWh (givetvis ska bara överskottsel tillverka drivmedel) allt annat lika…. hm… jag tror inte ens att det klara uppgiften och du ska veta att ur kol har priset sjunkit en bra bit under 2:-/l vilket anses vara det första etappmål som ska nås med drivmedel från kärnkraft.

  121. Topruner, väldigt många anser att den första av 300 civila GenIV som startar i Indien nästa år är en forskningsreaktor…
    Det för att den startade så, 2007 meddelades officiellt att tekniken lades ner, då den inte tycktes fungera…
    21/4 2008 gav tekniken resultat i några små forskningsreaktorer för att tekniken som detta projekt valt aldrig tidigare testats och det visade sig att det krävs mycket längre drifttid (egentligen användes ett fackuttryck som stämmer, men jag hoppar över det för att slippa förklara nu) före effekten kommer.
    Då satte utvecklingen i gång samtidigt som den första reaktorn modifierades, alla kunskap gav en modifierad modell som är 30% billigare.
    I våras brukade den reaktor som startar nästa år kallas för halvcivil…. efter frisläppandet av kostnaden för elkraft (om U233 och avsaltat vatten är gratis) blev 2rs (36öre/kWh) de fyra som byggs vidare ger 25öre/kWh…. de startar mellan 2017 och 2020, kallas den som regel för civil, den ger 500MWe, o.k. det är som en av Barsebäcks… men ändock.
    Jag tror att det blir mindre, max 100MWe som kommer revolutionera övriga världen, Indien klarar upp till 1,5miljard med hög välfärd med 300 och några tusen andra som ingår i deras 3delade kärnkraftsprogram.
    AP-1000 var sist jag kollade inte helt godkänd i Storbritannien, men många länder har visat sitt intresse.
    Italien har skrivit på för fyra i drift före 2020… de kommer kunna byggas på 3år, då delarna masstillverkas i kinesiska fabriker som byggs just nu.
    Visst kommer det byggas kanske knappt 1000 reaktorer motsvarande AP-1000.
    Men politiskt är de Indien och Rysslands GenIV som ska belysas i Sverige och andra länder med liknande syn från ledande politiker.
    Vi ser hur rädda danska politiker är i debatt på ex.…propagandafilmen som nu släppts visar ytterligare hur rädda kol och flumenergisystemskramarna är för konkurrens från modern kärnkraft.
    På ditt arbete är jag säker på att de inte vill veta att den teknik ni arbetar med är föråldrad…. Lite som den kommentar jag skrev till karaktären Åke S…. 😉  eller?
    Fråga dina kollegor hur många som sett Robert Busards föredrag från 2006 eller Eric Lerners från 2007… Jag tvivlar på att ens en tredjedel gjort det…. trots att de borde vara intresserade av alla former av kärnkraft..
    Testa på måndag och be alla du vet inte kollar på min blogg om de vet hur myonkatalyserad fusion och David LeBlancs patent fungerar… bara på kul…..
    Som att arbeta hela sitt liv med mopeder och inte ha en aning om scramjet….
    Överraska mig i veckan med att dina kollegor hänger med.

  122. Jag vill börja korrigera min långa kommentar ovan om läget och framtiden…
    För det första är det  Namibia som kanske får samma miljöbelastning som Kazakstan fått av sin expansiva uranbrytning.
    Nigeria är nog i en klass för sig, men inte av uranbrytning utan av spill då markledningar med olja sågas upp av lokala entreprenörer…
    Vilken tur att olja är lika naturligt som livet på jorden.
    Visst olja är till största delen fossil, men nybildas i högre takt an dagens mänskliga utvinning (skillnaden läcker ut genom havsbotten).
    För ungdomarna som läser här (förhoppningsvis bara de med humanistisk inriktning) vill jag visa hur vi kan veta att olja inte kan tränga upp snabbt genom jordskorpan.
    C14 är en kolisotop som bildas då atmosfärens kväve upptar en neutron från kosmisk strålning (neutronstrålning är en förutsättning för livet), den har halveringstiden knappt 6000år…
    Läs en minut…
    Genom att mäta halten C14 i den olja som utvinns kan man se att den inte är nybildad…
    Men hur lång tid tar det för det vatten som dras ner samma väg och till viss del tränger upp som superkritiskt ur havsbotten där det bildar skogar av metallrör???

  123. De reaktorer som nu byggs är billigare än kolkraft med 10% ränta, med 5% slår de naturgas. (enl. IAEA 6/9 2010)… på ett cirka…
    Kan araber räkna?
    Javisst, jag glömde, de tog mattematik från gammelgreker tillförde nollan och en massa till… “gav” den till oss, så våran elit kunde skapa den tillvaro som tog oss från åkerns slit till Internet. (glöm att dagens gamla byggde landet, det var någon procent som gjorde, troligen än lägre andel av befolkningen idag).
    En form av differentialekvationer fanns dock redan i Kina för mycket länge sedan… nu svävar jag ut igen… sorry…
    De reaktorer som kommer byggas i de fabriker som nu byggs för en aldrig tidigare skådad masstillverkning, kommer sänka priset till hälften på bara några år.
    Vattenkraft blir för dyr, vi kommer kunna spränga våra dammar och låta vårfloden brusa som i långliga tider.
    Vattenkraft bör vara intagsrör som bara tar 2/3 av maxflödet, utformade så djurlivet inte påverkas mätbart.
    Märkligt är annars att vissa pumpkraftverk köper el då den är billig och pumpar upp vatten, så släpper den ner och säljer el till en merkostnad på 10% plus ränta och driftkostnad..
    Vattnets lägesenergi omvandlas till elektrisk kraft med 90% verkningsgrad… upp så  ner….

  124. Labbibia

    Gunnar L
    glöm att dagens gamla byggde landet, det var någon procent som gjorde, troligen än lägre andel av befolkningen idag”
    Nej, där har du fel. Självklart bygger den föregående generationen vidare på det den fått i arv, utvecklar, lämnar vidare till nästa generation osv…..

  125. Reaktor uppkoppling i en moderat version, jämför med den 2008, 2006 2004, snacka om exponentiell tillväxt.
    2006, låg planerna nere, 2030 skulle kärnkraft ta fart.. Jo tack, om ett år ska jag lägga in en ny tabell från samma källa, då inser nog även karaktären Åke S vad som sker globalt… eller?
    India, NPCIL
    Kaiga 4
    Iran, AEOI
    Bushehr 1
    India, NPCIL
    Kudankulam 1
    Korea, KHNP
    Shin Kori 1
    Argentina, CNEA
    Atucha 2
    India, NPCIL
    Kudankulam 2
    Russia, Energoatom
    Kalinin 4
    Korea, KHNP
    Shin Kori 2
    China, CGNPC
    Lingao II-2
    Japan, Chugoku
    Shimane 3
    Taiwan Power
    Lungmen 1
    Canada, Bruce Pwr
    Bruce A1
    Canada, Bruce Pwr
    Bruce A2
    Pakistan, PAEC
    Chashma 2
    India, NPCIL
    Finland, TVO
    Olkilouto 3
    China, CNNC
    Qinshan phase II-4
    Taiwan Power
    Lungmen 2
    Korea, KHNP
    Shin Wolsong 1
    Canada, NB Power
    Point Lepreau 1
    France, EdF
    Flamanville 3
    Russia, Energoatom
    PWR x 2
    Russia, Energoatom
    Novovoronezh II-1
    Slovakia, SE
    Mochovce 3
    China, CGNPC
    Hongyanhe 1
    China, CGNPC
    Ningde 1
    Korea, KHNP
    Shin Wolsong 2
    USA, TVA
    Watts Bar 2
    Russia, Energoatom
    Leningrad II-1
    Korea, KHNP
    Shin-Kori 3
    China, CNNC
    Sanmen 1
    China, CGNPC
    Ningde 2
    China, CGNPC
    Yangjiang 1
    China, CGNPC
    Taishan 1
    China, CNNC
    Fangjiashan 1
    China, CNNC
    Fuqing 1
    China, CGNPC
    Hongyanhe 2
    Slovakia, SE
    Mochovce 4
    China, CNNC
    Sanmen 2
    China, CPI
    Haiyang 1
    China, CGNPC
    Ningde 3
    China, CGNPC
    Hongyanhe 3
    China, CGNPC
    Hongyanhe 4
    China, CGNPC
    Yangjiang 2
    China, CNNC
    Fangjiashan 2
    China, CNNC
    Fuqing 2
    China, CNNC
    Changiang 1
    China, China Huaneng
    Korea, KHNP
    Shin-Kori 4
    Japan, Tepco
    Fukishima I-7
    Japan, EPDC/J Power
    Russia, Energoatom
    Rostov 3
    Russia, Energoatom
    Beloyarsk 4
    Japan, Tepco
    Fukishima I-8
    China, CGNPC
    Yangjiang 3
    China, CPI
    Haiyang 2
    China, CGNPC
    Taishan 2
    China, CGNPC
    Ningde 4
    China, CGNPC
    Hongyanhe 5
    China, CGNPC
    Fangchenggang 1
    China, CNNC
    Changiang 2
    China, CNNC
    Hongshiding 1
    China, CNNC
    Taohuajiang 1
    China, CNNC
    Fuqing 3
    Korea, KHNP
    Shin-Ulchin 1
    Japan, Tepco
    Higashidori 1
    Japan, Chugoku
    Kaminoseki 1
    India, NPCIL
    Kakrapar 3
    Bulgaria, NEK
    Belene 1
    Korea, KHNP
    Shin-Ulchin 2
    Romania, SNN
    Cernavoda 3
    Russia, Energoatom
    Novovoronezh II-2
    Russia, Energoatom
    Leningrad II-2
    Russia, Energoatom
    Rostov 4
    Russia, Energoatom
    Baltic 1
    Russia, Energoatom
    Seversk 1
    Ukraine, Energoatom
    Khmelnitsky 3
    India, NPCIL
    Kakrapar 4
    India, NPCIL
    Rajasthan 7
    Russia, Energoatom
    Leningrad II-3
    Ukraine, Energoatom
    Khmelnitsky 4
    India, NPCIL
    Rajasthan 8
    Romania, SNN
    Cernavoda 4
    Undrar om denna kopiering funkar????  🙂 🙂  🙁

  126. Det vart kass  🙁
    I vart fall ser ni den civila GenIV jag brukar skriva om från Indien.
    2011  India, NPCIL Kalpakkam FBR 470MWe (brukar ofta specificeras med 500MWe vilket jag i djupare studier sett är något under 490MWe).
    Så här redogörs det av världens mest moderata kärnkrafts organ:
    India has 19 reactors in operation, and four under construction (two expected to be completed by 2010). This includes two large Russian reactors ( de som kostade 1,3$/We) and a large prototype fast breeder reactor (den som banat väg för de 300 som nu ingår i det indiska kärnkraftsprogrammet) as part of its strategy to develop a fuel cycle which can utilise thorium. Twenty further units are planned.  Ten further units are planned, and proposals for more – including western and Russian designs – are taking shape following the lifting of trade restrictions.
    Så kan Åke S och de som är teknikpessimistiska tolka allt sämre, trots att allt blivit extremt mycket bättre de senaste 5 åren på detta plan… och de flesta andra tekniska…. eller är oled kass?

  127. Mats

    Thomas #94, spillvärme kan omvandlas till el med en “powerbox” – men verkningsgraden är begränsad.
    Man kan undra om det finns kompetsen inom sverige att vägleda och ta fram beslutsunderlag för våra nuvarande reaktorägare?, vad avser systemlösningar för framtidens kombinerade system, reaktorer som producerar el och framtidens bränslen?! 
    Det vore önskvärt med tillämpad forskning inom detta område, forskning/teknikutveckling med focus på att ta fram underlag för investeringar i verkliga projekt, vår nuvarande regering kanske borde angagera sig lite mer än nuvarande lite avvaktande…….finns det en plan för forskningsanslag…och vad gör Energimyndigheten….

  128. arga gubben

    Nää, nu har de stannat igen. Ingen vind i Kristianstad idag.

  129. Märk att inga av de flytande kärnkraftverk som flyter ut nu från S.t Petersburg är med i listan.. (ett med två reaktorer har hittills byggts klart och stävat mot ishavet för att försörja utvinningen av olja och gas med elkraft och värme).
    Jag tror jag skulle kunna räkna upp inemot 100 reaktorer som är beställda och planerade i drift före 2017 som inte är med, men:
    Det spelar ingen roll, globalt behövs 100reaktorer för var och en som är i drift i dag, först då, kan vi slappna av och se ann framtiden, med solkraftverk tidvatten vadsomhelstkraftverk, då världen är trygg med fri utbildning, sjukvård och en global välfärd långt över det vi av byråkrati och okunskap förtryckta i Norden.

  130. #124
    Jag brukar dra ut saker till sin spets (ofta så långt att den visar fel, spetsen 😉 ) så brukar jag påstå att allt norr om Daläven kostat svenskar som lever söder om minst 20.000miljarder de sista 40 åren… (sug på den… den är tung och jag vet att minst 25% av de som levat norr om DÄ varit mycket lönsamma och produktiva, till skillnad mot kanske 90% söder om).
    Men Labbibia, om allt slagits sönder i WWII, skulle vi inte utvecklats som våra grannländer men bättre då vi hade avsevärt bättre förutsättning?
    Hur mycket skulle medborgarnas välstånd öka om idag de flesta offentliga maktstrukturer slogs ut som i Tyskland efter krigsförlusten?
    Det kan vara mer ekonomiskt (betyder hushållande? Mats F?) att slå allt sönder och samman med jämna mellanrum, om det är det enda sättet att starta om den utveckling som styrs av Parkinsons lag.
    Nu hoppas jag någon som druckit mycket vin vill gå emot, vad med Gunbo?

  131. Labbibia

    Thomas # 116
    När solljuset kommer till Jorden så har det knappast en temperatur på 6000 grader. Möjligen 60-70 grader som högst?
    En bilmotor jobbar väl som bäst vid en temperatur på ca 80-85 grader C ?
    Är det verkligen totalt omöjligt att få denna energi återanvänd  som ex el till batterierna i bilen.
    Helge # 115
    På vilket sätt motsäger ditt inlägg tanken på att använda spillvärmen från en uppvärmd motor? Ta mitt brainstormsförslag med att klä motorhuvens insida med någon form av energiupptagande material a´la solceller….
    Menar du att motorhuvarna undertill  idag kläs för att upprätthålla optimal arbetstemperatur på motorerna? Eller sitter där bara ljudisolerande material?  

  132. Korrigering:
    “minst 25% av de som levat norr om DÄ varit mycket lönsamma och produktiva, till skillnad mot kanske 10% söder om).”

  133. Labbibia;
    Jankare på 60:talet speciellt Pontiac GTO 65 389 hade 120C …
    Men de gamla ångmaskinerna hade 160C och med trekolvssystemet från den duktiga skotten (högtryckskolv, så mellan tryck och låg tryck, med så olika diameter att de alla gav samma effekt på vevaxeln, jag tog en kurs som motorman på sjöbefälsskolan i ångmaskinsteknik, såklart gav jag fan i att hämta ut examen, kunskap är givetvis viktigare än korkade examina… eller hur alla med över 300 poäng?) de hade under 10% verkningsgrad..
    Labbibia verkningsgraden i termiska processer styrs lite efter något som kallas carnotkurva…
    SAAB jobbade med en häftig ångmaskin till bilar på 70:talet..
    Jobba med 1000C till utetemp i en sluten cykel… då du… gissningsvis kan man uppnå 65% verkningsgrad… teoretiskt….
    750C till 490 C kommer till 49% med ett slutet super kritiskt CO2 system och de bästa neodympermanentmagnetgeneratorerna…. (världsrekord i långt ord?)

  134. Labbibia

    Gunnar L # 130
    1.  “Labbibia, om allt slagits sönder i WWII, skulle vi inte utvecklats som våra grannländer men bättre då vi hade avsevärt bättre förutsättning?”

    Hm….Det är lättare att utvecklas från en “låg” nivå. Jfr ex “tigerekonomierna” i Asien. När de nått upp till en viss nivå saktades utvecklingstakten ner…..
    2. “Hur mycket skulle medborgarnas välstånd öka om idag de flesta offentliga maktstrukturer slogs ut som i Tyskland efter krigsförlusten?”
    Öst eller Västtyskland? 😉

  135. Nu blev jag så imponerad av James Watt så jag läste i Wiki om grabben.
    Om ni inte är mycket intresserade, se åtminstone på ångcykeln i botten, något för Biltema? YES YES

  136. 134#
    Tack, Lbbibia, jag ger mig, så enkelt löses inte dagens civilisationsproblem med den överutveckling som successivt sänker medborgarnas livskvalitet sedan 40 år….
    Ge mig tillbaka på den sista om överutveckling som….Det kan möjligen stimulera bloggen kung,     på styrelsestrukturer  Jonas N (eller hur Gunbo och Uffeb?)

  137. Gunnar Littmarck #130
    Du försöker provocera och det är kul.
    “Hur mycket skulle medborgarnas välstånd öka om idag de flesta offentliga maktstrukturer slogs ut som i Tyskland efter krigsförlusten?”
    Ja du Gunnar. Det kan du fundera över.
    Men utan enorma insatser från omvärlden och till stor del USA så hade det kanske aldrig repat sig.
    Och det roliga du skrev om hur kostsamt Sverige är norr om Dalälven var kul.
    Men det handlar inte om att dela in människor i dugliga eller odugliga Gunnar. För även om du är bäst och mest allvetande så bidrar du inte mycket mer till utvecklingen i världen än ett flitigt bi.

  138. Labbibia

    Gunnar L
    Vi är helt överens om att medborgarnas livskvalitet sjunker….men inte på alla områden. Materiellt får vi det bättre och bättre, men den personliga friheten beskärs mer och mer…?
    Ungefär som en kossa i ladugården jämfört med en vild vattenbuffel? Massor med käk, men rörelsefriheten begränsas?
    Mätta medborgare gör sällan uppror?

  139. Toprunner

    Gunnar L #125: De bygger PWR i Sanmen  (osv i Kina) men det är AP1000, extra intressant eftersom det är nästan som IKEA-kärnkraft 🙂 !
    Sen finns det gott om internutbildning.. oroa dig inte.. men fullt upp med dagens problem. Gen 4 är morgondagens… det är verkligheten i det kommersiella!

  140. Labbibia

    Gunnar L
    Den enda som är verkligt fri, är den som inte äger någonting…….?
    Har läst någonstans att bland de nomadiska indianstammarna på den amerikanska prärien, så skänkte man bort de flesta av sina ägodelar för att slippa ha så mycket att släpa på…..Det blev något slags “Svarte Petterspel”, den som fick grejorna kvar på hand, blev losern….

  141. Labbibia #138
    Har du några intressen som du förhindras att utöva på grund av samhället? Vad in i helvete sjutton menar du?
    Jag fattar noll av det resonemanget. Men blir väldigt nyfiken på hur du tänker och menar.
    Jag tänkte fråga dig vilka kriminella böjelser du har men som du tvingas avstå från.
    Det sista var ironi. 🙂
    Men jag kan ana att du menar annan sorts valfrihet. Jag kan ana att du kanske vill ha en egen och privat kontroll på olika sorters service som samhället tillhandahåller men till samma kostnad som den som bekostas gemensamt.
    Lycka till säger jag. Den dag som vi med god ekonomi kan köpa vår service privat så förlorar vi nog inte några pengar direkt.
    Men herrejöstanes så dyrt det blir med alla murar, grindar, nattvakter och rörelsedetektorer och poliser som ska skydda vår lilla värld i ett redan litet land från våra egna arbetslösa eller bortsorterade.

  142. Labbibia

    Uffeb # 141
    Jag anar att du inte har en aning om vart jag syftar… 🙂

  143. Labibia #142
    Håller med dig.
    Det var därför jag frågade. Jag fattade noll. Men blev nyfiken.

  144. Tjena! Toprunner, globalt och för mänskligenheten de närmaste åren går det inte att ge dig motkommentarer med tryck, men…
    Med en dåres envishet spelar det ingen roll på bara 10 års sikt…
    Om vi ska bygga så mycket kärnkraft att de ens kan påverka kolutvinningsökningen för att inte tala om naturgas, (givetvis finns inget egenvärde i att konkurrera ut dem, men som referens…. och det faktum att de är för dyra för att bygga en global välfärd till 2050) duger ej AP-1000 eller någon av dess bästa kusiner…
    Politiskt duger SVbr-100 och den snabba bridreaktor med toriumcykeln Indien startar nästa år, i vår del av världen för att svänga opinionen från destruktiv flumkraft till konstruktiva energisystem.
    Vi i den dekadenta delen av mänskligheten kan enkelt effektivera oss genom ett decennium. (bara inse hur stor energibesparing det vore att avsätta alla parlament och myndigheter som inte bidrar till medborgarnas livskvalitet och flytta de ytterst få som blir kvar till Internet)..
    Hur mycket energi drar energieffektiviseringsmyndigheten?
    Birgitta Dahl var ansvarig minister i tidigt 80:tal, på hennes departement var det 23C i personalgaraget och då vi sänkte vissa kontorsrum mot 21C, blev det uppror.
    Vid ett offentligt besök påpekade Birgitta att här finns ju mycket el, pekandes på alla eluttag….
    Hon ansåg att vi enklast kunde spara genom att minska antalet fasta uttag…. Kan den dyra damen läst fysik på grundskolenivå och uppsnappat till betyg 3???? jag tvivlar… men sosseminister blev hon… kanske bara slagen av Fäldin och jahajahajohanson i dirrekta kostnader, långsiktiga blir svårt att utvärdera…. hm… var är karaktären Åke S, hur många tusen miljarder kostade Dahlskan?  5-10 gissar jag spontant och några tusental förtida dödsfall.

  145. Labbibia

    ….så jag ska ta några exempel.
    1. FRA-lagen.
    Ett direkt brott mot vår egen grundlag. En skandal utan dess like. Men (nästan) ingen reagerar….för mätta medborgare gör sällan uppror?
    2. Biltullarna i Sthlm.
    Som tillkom genom en ren parodi på det styrelseskick som påstås råda i Sverige….
    Ur yttrandefrihets-
    Varje svensk medborgare är gentemot det allmänna tillförsäkrad rätt enligt denna grundlag att i ljudradio, television och vissa liknande överföringar samt filmer, videogram, ljudupptagningar och andra tekniska upptagningar offentligen uttrycka tankar, åsikter och känslor och i övrigt lämna uppgifter i vilket ämne som helst.”
    Ringer det någon klocka Uffeb?

  146. Gunnar L #144
    Vad dricker du en fredagskväll? Rött eller vitt? Vad föredrar du? Beror det på vilken mat du tänker äta, elle gör du som jag?
    Jag väljer vinet först och fixar sedan en mat som passar till vinet. 😉

  147. #140
    Jag har faktiskt levt efter det i snart …hm… 25 år nu…
    Jag har minskat antalet prylar och ändrat nytt till gammalt, släng till byggom, från fem bilar och fem båtar, till en kanot en 21fotare och en Skoda 2002…
    Jag vet att kunskap och förmåga är oerhört mycket mer värdefullt än prylar och kapital, i vår del av världen.
    Och du det bästa… ingen kan beskatta kunskap eller förmåga, he he he.
    I sosse Sverige var det både lönsamt och roligt att lära sig allt om allt, skulle jag blivit kvar i USA 1976, skulle jag specialiserat mig och kanske haft 1000sentals anställda på mitt ansvar nu. Hualige vilka långa ofria arbetsdagar…
    Då jag vägrar det på de svenska politikernas villkor har jag vunnit livskvalitet, men kanske landet förlorat några tusen hightechjobb, bara från mig? Från de som verkligen kan skulle det blivit någon miljon och landet vore nu världsledande i alla tunga branscher.
    Om inte socialiseringen och avundsjukan med det undandragit incitamentet, så en del gjort som jag, en del flyttat utomlands…
    Vad tror du Uffeb, hur mycket har den svenska medborgaren förlorat på den politik som utformades i slutet av  sextiotalet och överlevde genom de norrländska rösterna tills hela landet genomsyrats och nu det största arbetarpartiet är M, det forna arbetarpartiet är nu det största beroendepartiet… Eller?

  148. Uffeb det var en så mentalt tuff vecka så jag tog en torr cabarne som jag faktiskt själv gjort (minst 70l spolades ut innan jag fick till något enkelt jag är nöjd med). Till det har jag inmundigat en nudelsoppa… (jag orkar inte vara social, det får bli med dig här… så slappt och lika tänkvärt samt berikande…)
    Min äldsta som (som försöker få mig att läsa mycket tunga böcker om …. det tar jag någon annan gång i ett annat forum) plockade blåbär som en galning här för några år sedan ska få blåbärsvin… QUE!
    Jag testar efter lite erfarenhet med socker som inte är renat, så kallat brun farin… vi får se om det går ut på gräsmattan eller blir en gåva…
    Vad dricker du Uffeb?

  149. Gunbo

    Gunnar L #130,
    “Nu hoppas jag någon som druckit mycket vin vill gå emot, vad med Gunbo?”
    Jag har faktiskt inmundigat så pass mycket rödtjut (som jag nyss lärde mig vad det är) till hjortsadeln att jag inte vågar mig på ett svar på din fråga. Får återkomma i morgon.
    God natt!

  150. Appropå, se en verklig kvalitetsfilm på temat romans, vin och den amerikanska drömmen, den bygger på verkligheten.
    Bottle shock
    Yes we can  (borde jag inte flytta över till andra sidan pölen där min mentalitet inte avviker så grovt?)

  151. God natt min vän Gunbo, sov gott och dröm vackra drömmar.

  152. Gunbo

    Uffeb #137,
    “Men det handlar inte om att dela in människor i dugliga eller odugliga Gunnar. För även om du är bäst och mest allvetande så bidrar du inte mycket mer till utvecklingen i världen än ett flitigt bi.”
    Klockrent Uffeb, klockrent!

  153. Labbibia

    Säga vad man vill om den politik som utformades i slutet på 60-talet, men dan var åtminstone teknikoptimistiskt/realistisk.
    Man satsade stenhårt på kärnkraft, till skillnad från ett visst  borgerligt parti som “allierade” sig med den Sovjetinfiltrerade vänsterrörelsen (jo så var det) i landet.
    När man tänker lite på det……..FNL-rörelsen transformerades till “Kärnkraft nej tack”. Tror fan att Ryssarna inte ville ha ett (eventuellt) fientligt land i närområdet med kärnvapenkapacitet. Rena klippet för dem om de kunde påverka utvecklingen med “kärnkraft, nej tack”.

  154. Gunnar Litmarck #147
    Om alla kunde finna sin egen livskvalitet utan att utnyttja andra för att nå den, så skulle allt nog vara härligt.
    Din beskrivning av att Norrland, med sina få människor, skulle ha lett fram till att vi fått ett nytt arbetarparti som heter M är ju ett ett totalt obegripligt nonsensprat.
    Fattar du noll om marknadsföring? Troligen har du begränsade kunskaper i det ämnet eftersom du tror att verklig kunskap (bäst produkter) vinner över skicklig marknadsföring.
    Men så är det inte. Tyvärr ska man kanske tillägga.
    Men att du uppfattar M som ett arbetarparti är för mig helt obegripligt. Går du bara efter slogans i stil med “Det nya arbetarpartiet” eller vad det kan vara. Nej så långt gick dom väl aldrig – det räckte med väl “De nya Moderaterna” och en skicklig retorik om en “ny arbetslinje”. 

  155. Toprunner

    Gunnar L #144:
     Min våta dröm har alltid vart att ta haggan Dahl under ena armen och sätta full fart mot närmaste vägg för att köra in hennes huvud i densamma, dra ner underbyxorna och åskådligöra följande reklamslogan

  156. Gunnar Littmarck #148
    Just nu dricker jag ett sista glas Oude Kaap ur en box från systemet. Prisvärt vitt vin och praktiskt med plastpåse i låda för en som ibland tar ett par glas utan stort stohej.
    Men när det gäller dyrare viner i gott sällskap så väljer jag faktiskt vin först och maten därefter. Inte alltid, men ibland när det finns roliga viner att välja på.
    Men nu är det jäsp och snart sängläsning och skön sömn för mig.

  157. Gunbo

    Osmakligt och plumpt! Har du inte lämnat stenåldern ännu?

  158. Tack för den Toprunner.
    Den ger bild åt Frans G Bengtssons skrönor om de som levde i Norden förra högre temperaturs period.
    De rodde uppför Temsen och fäste sina långbåtar vid “bron” under skurar av pilar och upphettad tjära, eld med allt vad de hysteriska engländarna fann på.
    Så roddes brofundamenten loss och strider kunde slås på en sida i taget…
    Efteråt sände den engelska kungen ett bud om lösenförhandling… (nu visar filmen vårt kulturarv 😉 )
    -Det månde bli en god lösen, ty vi äro av ett sällsamt håglöst släkte.
    En bra historia ska aldrig skärskådas och tål att färgas vid behov. (Gunnar Littmarck sep. 2010)

  159. Labbibia

  160. Uffeb jag hade en period för kanske 7 år sedan då jag alltid såg till att det fanns just det sydafrikanska vinet hemma, men så efter ett tag tog det stopp…. inte vet jag varför, men nu gillar jag det… minus—3???

  161. Tänk jag måste blivit gammal, det var så länge sedan jag hörde Lars Ekborg så jag skrattade så tårarna rann… livet leker.
    Definition av mänskliga lyckliga stunder lär vara när vi är omedvetna om jaget och vår kropp, då har jag varit det i majoriteten av mitt liv… Jag som trodde jag var olycklig för att mänskligheten skulle kunna haft fred och en global välfärd för 30 år sedan….
    Fråga till Gonbo:
    Är det egoistsikt att vara lycklig när det finns så mycket olycka?
    Eller är lycka ett tillstånd som sprider sig som en cancercell och inte stoppar fören den möter kompakt illvilja och missunnsamhet?

  162. Toprunner

    Gunbo #157: Jag ska villigt erkänna att folkomröstningen och dess efterspel gjorde saker med mig jag inte riktigt kan förklara själv. Kanske en seans på din brits kan hjälpa mig förstå vad som hände?

  163. Här kan karaktären Åke S läsa den sämsta seriösa sammanfattningen om dagens mänskliga läge vad gäller avancerad reaktor teknologi:
    Just här bara gotta dig och fin argument som styrker din övertygelse, så du blir än mer förutsägbar… (sorry jag kunde inte låta bli…)  🙂

  164. Gunbo

    Gunnar L #161,
    “Är det egoistsikt att vara lycklig när det finns så mycket olycka?
    Eller är lycka ett tillstånd som sprider sig som en cancercell och inte stoppar fören den möter kompakt illvilja och missunnsamhet?”
    Du hade inte behövt fråga, du har ju svaret själv.

  165. Christopher E

    Gunnar L;
    Stort tack för dina uppdateringar om kärnkraftsutveckling och uppbyggnad i olika poster härovan! Den långa listan över åren framöver är helt fascinerande. “Parantes”… 😀
    En liten petimeterkommentar dock till #123. Vi gillar ju båda Indien… så jag vill påpeka att det inte var inte araberna utan indierna som uppfann decimalsystemet, våra siffror och nollan, av allt att döma på sent 500-tal AD. Att siffrorna kallas “arabiska” beror på att västvärlden fick dem därifrån och inte direkt från Indien.
    Frånvaron av nollan i västvärlden var ju förresten orsaken till vår tideräkning, som ju börjar på år 1 och inte år 0. Vilket ledde till att nästan hela världen firade senaste millennieskiftet ett år för tidigt (det var nästan meningslöst att försöka förklara att det nya millenniet började 1 jan 2001…). Den folkliga synen segrade mot den korrekta matematiken.

  166. Christopher E, vilken underbar kommentar att starta dagen med, stort tack. 🙂
    Tänk om alla var medvetna om att verktyget mattematik är helt avgörande för att tagit oss från åkern till Internet…

  167. Håkan Sjögren

    Labbibia # 131 : solljuset, som är en vågrörelse har ingen temperatur alls, då det inte innehåller några partiklar med massa. Däremot har det en färgtemperatur som är nära 6000 grader, vilket kan beräknas med hjälp av Wiens förskjutningslag. Mvh, Håkan

  168. Thomas

    Labbibia #131, ljusets spektrala fördelning motsvarar 6000 grader, och det är den temperaturen som avgör med hur stor verkningsgrad man kan utvinna energi. Det är inte omöjligt att utvinna energi ur spillvärmen från en bil, bara mycket svårt, dyrt och det kan bara ske med låg verkningsgrad. Inget som lockar med dagens teknik alltså.
    Skall du få upp verkningsgraden, är det istället konstruktionen av motorn och hur effektivt den utnyttjar bränslet du får titta på.

  169. Tomas #168, det där stämmer mitt på dagen en solig torr och molnfri dag. Men visste du att solljuset en mulen dag kan solljuset komma upp i 10 000 grader!?
    Tror du att solcellerna är mer effektiva då?

  170. Gunnat L  #166
    Tänk om alla var medvetna om att verktyget mattematik är helt avgörande för att tagit oss från åkern till Internet…
    Och att de fåtal som stannat kvar på åkern kan föda ett så stort antal. Fast då får vi nog slå de senaste grillerna ur huvudet att ekologisk odling som bygger på kompostering, ytgödsling, plöjningsfritt eller att elda upp halm i värmeverk, eller det senaste feltänket att fördärva och nedgradera prima naturgödsel, skörderester m.m genom biogastillverkning.
    Organisk kemi och oxidation är tyvärr inte människans starkaste sida. Syre plus vatten är världens effektivaste renhållningsarbetare, även det starkaste stål blir till en värdelös rosthög om det inte skyddas med lämplig ytbehandling.

  171. Korrläsning är inte min starka sida, Gunnar skall vara.

  172. Gunnar, apropå kärnkraft så är det en “anonym” person som på UI påstår att uranet bara räcker 4-7 år:
    Men det var en intressant lista med kommande nya kärnkraftverk. Finns det officiella listor på detta eller är det bara info som du har samlat på dig?

  173. #172
    Det var ett moderat organ för världens nationers officiella information, lite som IAEA, men kanske än mesigare, jag brukar ofta hänvisa till dem för att “ankra” de som anser att jag lever i min egen värld…
    Märk att listan är extremt utvidgad vart år sedan jag började följa och att Kina för 2016 och 2017 inte är specificerad..
    Jag kan lägga in en länk senare vid nästa paus…

  174. Börje Gustavsson; jag önskade en förhandsläsning från de som inte delar min syn på vare sig problemformuleringen eller mina lösningsförslag.
    sorry du är allt för mycket som jag…..tur du inte anmälde dig..
    NicklasE (är du grabben med hästarna?) lägg några timar om dagen här. så är du ikapp i ett nafs..  🙂
    Jag försöker tänka själv (med blandade resultat… hittills bara negativa…hm.. skam den som ger sig..) så jag har några storheter som mailvänner, där jag får mina funderingar tillbakabollade med starka vetenskapliga skruvar… 😉 lite består dock de skruvarna… inte mycket… men dock…
    Jag hade orkat fortsätta även om mina vetenskapliga idoler alltid sänkte mig, ty jag drivs av nyfikenhet och inte prestige… hur är det med karaktären Åke S?  hm….

  175. Thomas

    Jonas N, nej jag har inte tänkt på att moln genom selektiv absorbtion/reflektion kan ändra den effektiva temperaturen på instrålat ljus, men när du säger det låter det inte orimligt.
    Givet att du optimerar din solcell för detta mer kortvågiga spektrum så bör man då kunna få högre verkningsgrad en molnig dag. Naturligtvis är den totala ljusnivån lägre så att man totalt sett får mindre energi, men man kan utnyttja större andel av det ljus som finns.

  176. Thomas då det ligger i närheten av din doktorsavhandling kan jag kanske bistå?
    Vill du veta eller låta JonasN än en gång trycka ner dig med sin överlägsna kunskap?
    Solceller kommer definitivt få ett stort genomslag och om mindre än hundra år ta över majoriteten av nyproduktionen av energisystem… solklart  🙂
    Problemet är vägen dit utan att desperata befolkningsgrupper startar än fler oroshärdar….
    Vill man vara cynisk och enbart rationell, framstår en gigantisk utbyggnad av energisystem så alla får minst dagens relativt låga svenska välstånd som billigare än att 3/4 av befolkningen dör långt förtida.

  177. Thomas, en guldstjärna för ett helt igenom sansat svar. 
    Det är ju så att spektrat för det (genom molnen) genomsläppta ljuset ligger förskjutet åt de högre frekvenserna, så att dess tyngdpunkt motsvarar en svartkropp av (upp till)  T = 10 000 K.
    Men spektrat har alltså en annan fördelning då. För egentligen är det ju fortfarande solens (motsv ~6000 K) men med de frekvenserna trunkerade/starkt filtrerade …

  178. NicklasE, jag är korkad, du är vuxen, varför ska du blädda på en webbsida för?
    Mig vara idiot!!!!
    Se här i stället..
    Tänk att jag korrigerade gubbskallen före reprimander från de mer kommunikationsbegåvade…  😀

  179. JonasN och Thomas har ni följt med på forskningen som separerar våglängder och därigenom bygger solceller med den teoretiska maxgränsen 65%?
    För mig som båtintresserad är inte bara priset och livslängden väsentligt..
    Annars är för er ungdomar som läser här solen energi runt 1370W/kvm på detta avstånd, det blir aldrig totalt 10.000W/kW… Bara tänk. lokalt …hm… aldrig totalt…
    Nu kommer en ny billig solcell med frecnell lins som ger aningen bättre prestanda..
    Jag tänker ha en solfokuserande motordriven solfångare på den båt jag hoppas byta detta flerfamiljshus i Norge mot… (om typ 5 år då Internet och båtbyggarteknik utvecklats från dagens stenålder)… så ska jag blogga från alla världshaven och dess samlade kuster…

  180. Labbibia

    Thomas # 168
    Och Håkan S # 167
    Stort tack för svaren….
    Något lite klokare blev jag förhoppningsvis på kuppen.
    Men jag lovar/hotar att komma upp med fler “Baltazar-ideér.
    Vem vet, en vacker dag kanske det blir “rätt”? 😉